Report error Found 45 Enz. Inhib. hit(s) with Target = 'Ephrin type-A receptor 7'
Affinity DataKd: 490nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataEC50: 3.26E+3nMAssay Description:Inhibition of human EPHA7 incubated for 30 mins by Kinobead based assayMore data for this Ligand-Target Pair
Affinity DataKd: 766nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
Affinity DataKd: 887nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
Affinity DataKd: 200nMAssay Description:Binding affinity to human EPHA7More data for this Ligand-Target Pair
Affinity DataKd: 2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 630nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 5.30E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 1.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 3.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 1.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 860nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 1.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 110nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 960nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 290nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 370nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 1.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 2.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 580nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 590nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 440nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 270nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 50nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 330nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 380nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKd: 1.50E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataIC50: 1.80nMAssay Description:Inhibition of EphA7 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 4.20nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assayMore data for this Ligand-Target Pair
Affinity DataIC50: 39.2nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 56.3nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using [protein fragment, 39 aa] incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
Affinity DataIC50: 162nMAssay Description:Inhibition of human wild type partial length EphA7 (Y608 to S912 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
Affinity DataIC50: 190nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
Affinity DataIC50: 665nMAssay Description:Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of human EPHA7More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of EphA1More data for this Ligand-Target Pair
Affinity DataIC50: 1.12E+3nMAssay Description:Inhibition of EphA7 by [gamma33-P]ATP based assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamma33ATP] by ra...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
Affinity DataIC50: 3.00E+4nMAssay Description:Displacement of biotinylated ephrin-A1-Fc from mouse EphA7 Fc preincubated for 1 hr followed by ephrin-A1-FC addition and measured after 4 hrs by ELI...More data for this Ligand-Target Pair
