Report error Found 180 Enz. Inhib. hit(s) with Target = 'Cyclin-A1/Cyclin-dependent kinase 2' Sort by
Affinity DataIC50: 1.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Affinity DataIC50: 1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.60nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 1.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 2.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 3.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 3.40nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 3.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 5.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 5.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 5.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 8.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 9.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 9.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 16nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Affinity DataIC50: 17nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 17nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 21nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
Affinity DataIC50: 24nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 24nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 31nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
Affinity DataIC50: 46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 49nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 57nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 58nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 59nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 59nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair

































3D Structure (crystal)













