BDBM50557749 CHEMBL4783244
SMILES C1COCCOc2cccc(c2)-c2cnn3ccc(N1)nc23
InChI Key InChIKey=ZQWGOPOBEHTGBB-UHFFFAOYSA-N
Data 3 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 3 hits for monomerid = 50557749
Affinity DataIC50: 75nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Affinity DataIC50: 4.40E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair