BDBM394406 2-(6-amino-5-(piperazin-::US10308614, Example 7
SMILES Nc1nnc(cc1N1CCNCC1)-c1ccccc1O
InChI Key InChIKey=SZKHGLTYXIDOFH-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 6 hits for monomerid = 394406
Affinity DataIC50: 214nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
Affinity DataKd: 73nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Goethe University Frankfurt
Curated by ChEMBL
Goethe University Frankfurt
Curated by ChEMBL
Affinity DataKd: 135nMAssay Description:Binding affinity to SMARCA2 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
Affinity DataKd: 26nMAssay Description:Binding affinity to polybromo-1 (5) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Goethe University Frankfurt
Curated by ChEMBL
Goethe University Frankfurt
Curated by ChEMBL
Affinity DataIC50: 370nMAssay Description:Inhibition of SMARCA2 BD (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 550nMAssay Description:Inhibition of SMARCA4 BD (unknown origin)More data for this Ligand-Target Pair